Sequence:YGR125W

From Ytpdb

Jump to: navigation, search

YGR125W protein sequence

>YGR125W orf 1036 aa
MGRTIRRRRSNSSLSEAISVSLGINQDSSVNKMHRASVSAMSPPLCRSYMSGFFTGGNSPMINNLSDSKL
PISNKQHPKVIHGSENLHRQTAQLSNEFCSSSVEENSPTIKDYMDIIGNGDRKDDQSMRTIEENIDEEYS
DEYSRLLLSPASSNVDDDRNRGLQNSSLPELEDGYAGGYQSLRPSHNLRFRPRNLWHMCTSFPSKFAHYL
PAAVLGLLLNILDALSYGMIIFPITEPVFSHLGPTGISMFYISTIISQAVYSGGWSSFPSGIGSEMIEIT
PFYHTMALAIKEALAGNDDEIITTTIFCYVISSMLTGVVFYALGKLRLGKIVGFFPRHILIGCIGGVGYF
LIITGIEVTTRVAKFEYSWPFFSGLFTDYDTLAKWLLPVLLTVVLIGTQRYFKNSLVLPSFYILTLVLFH
FIVAIIPTLSLDALRQAGWIFPIANSDSKWYDHYRLFNVHKVHWSLVLQQIPTMMALTFFGILHVPINVP
ALAMSLQMDKYDVDRELIAHGYSNFFSGLLGSVQNYLVYTNSVLFIRAGADSPFAGFLLIALTICIMIIG
PVIISFIPICIVGSLIFLLGYELLVEALVDTWNKLNRFEYLTVVIIVFTMGIFDFVLGIIVGILIACFSF
LVDSTKLQTINGEYNGNVARSTVYRDYVQTKFLDGIGEQIYVLKLQNLLFFGTIISIEEKIERLLQISNK
DATKRRIKYLILDFKNINADNIDYSAAEGFNRIKRFTETKRIKLIISSIKERDRIYNAFNNVGLLNDVEL
FADLNSALEWCENEFLFQYKQLRKKAKERLEEGKQNNVVSAVIAATKNKKIDTIGNGLNRGSNGDTARNL
MSLPTNTPRNYQILSVAQNVFVNDEQAVKNFKKEYKDDEPVLPILLFALKQYRPDIISEVQKVREKEIKF
WAQLCPYFTRRRLASQSHLLHADNIFFLVETGMLKATYELPQGTLYEIFSNGTCFGKIIAPGNAMPREQK
LTIETETDSVLWVIDSSSLNKLKEDNLALYVEVALMVMCIKDTRFKELLGYTLVSA

YGR125W sequence

>YGR125W orf 3111 nt
ATGGGAAGGACTATTAGGAGACGCCGGAGTAATTCGTCGCTTTCGGAGGCCATATCAGTTTCTTTAGGAA
TAAATCAAGACTCATCTGTGAACAAGATGCATAGAGCGAGTGTTAGCGCAATGTCTCCTCCATTATGCCG
TTCATACATGAGCGGATTTTTTACTGGTGGAAACTCACCTATGATCAATAATTTGTCGGATTCAAAACTT
CCCATCTCGAACAAACAACATCCTAAAGTGATACATGGATCAGAAAATTTGCATAGGCAGACAGCTCAAC
TATCCAATGAATTTTGCTCCTCTTCTGTGGAAGAAAATTCTCCCACAATTAAGGATTACATGGACATTAT
AGGCAATGGTGATAGAAAAGATGATCAATCTATGCGTACTATAGAAGAGAATATTGATGAAGAATATTCA
GATGAGTACTCCAGATTGCTACTTAGCCCAGCATCGTCTAACGTGGACGATGACCGAAATCGAGGACTAC
AGAATAGTTCACTACCGGAATTAGAAGATGGTTACGCGGGCGGATATCAGTCACTTCGTCCCTCCCATAA
TTTAAGGTTTAGGCCAAGAAACTTGTGGCATATGTGTACGTCATTTCCTTCCAAATTTGCACATTATCTG
CCCGCAGCAGTGTTAGGTTTGCTTTTGAACATTTTAGATGCCTTATCTTATGGTATGATCATTTTTCCAA
TCACAGAGCCAGTTTTTTCTCATTTAGGGCCCACTGGTATATCCATGTTTTATATTTCCACCATAATATC
ACAAGCCGTGTACTCCGGAGGCTGGTCGAGTTTTCCTTCCGGGATTGGGAGTGAAATGATTGAAATTACT
CCGTTTTATCATACAATGGCATTAGCTATAAAAGAGGCATTAGCAGGTAATGATGACGAAATCATAACGA
CAACGATATTTTGTTATGTGATAAGTTCGATGCTCACAGGTGTCGTTTTCTATGCATTGGGTAAACTACG
ACTAGGAAAGATAGTGGGATTTTTTCCACGACACATATTGATTGGCTGTATTGGAGGTGTTGGTTATTTC
TTGATAATTACAGGAATTGAAGTCACAACGAGGGTGGCGAAATTTGAATATTCATGGCCTTTTTTTTCAG
GGCTGTTTACGGATTATGACACATTAGCGAAATGGTTATTACCTGTACTATTGACTGTAGTTTTAATCGG
CACTCAACGCTACTTTAAGAACTCACTCGTTTTGCCAAGTTTTTACATCTTGACGTTAGTTTTGTTTCAT
TTTATTGTTGCGATCATTCCAACATTATCCTTGGATGCTTTGAGACAAGCTGGATGGATTTTTCCTATTG
CCAACTCAGATAGTAAATGGTATGACCATTATAGATTATTTAATGTCCATAAAGTTCATTGGTCACTAGT
TTTGCAACAAATACCAACGATGATGGCATTGACATTTTTTGGTATCCTACATGTTCCTATAAATGTTCCT
GCGTTGGCTATGTCACTACAAATGGATAAGTATGATGTTGACAGAGAATTGATTGCACATGGTTATTCCA
ACTTTTTTAGTGGATTATTAGGTTCTGTCCAAAATTACTTGGTATATACCAACAGTGTTCTGTTTATTAG
GGCGGGCGCTGATTCGCCATTCGCTGGGTTCCTTTTAATAGCTTTGACTATCTGTATTATGATCATTGGA
CCAGTCATAATATCATTCATTCCAATCTGTATAGTGGGCTCTCTAATTTTCCTACTAGGCTACGAGTTAT
TAGTGGAAGCGTTGGTCGATACATGGAATAAATTGAATAGATTCGAATATTTGACTGTTGTCATTATTGT
TTTCACGATGGGTATCTTTGATTTTGTCCTAGGTATCATCGTTGGCATTTTAATTGCATGTTTTTCGTTT
TTGGTGGATAGTACGAAATTACAAACCATTAACGGTGAATATAATGGGAACGTCGCAAGAAGTACAGTAT
ATCGTGATTACGTTCAAACAAAATTTTTGGATGGAATTGGTGAACAAATATATGTTTTAAAGCTCCAAAA
CCTTCTGTTTTTCGGAACAATCATATCTATTGAAGAGAAAATTGAAAGATTGCTGCAAATAAGTAACAAA
GATGCAACAAAACGCAGAATAAAGTATTTAATATTGGACTTTAAAAATATTAATGCCGACAATATTGACT
ATTCTGCGGCAGAAGGTTTCAATAGAATTAAAAGATTCACGGAAACCAAAAGAATCAAACTAATCATATC
TTCAATCAAAGAAAGGGACCGTATTTACAACGCCTTCAATAATGTGGGATTACTAAACGATGTGGAATTA
TTTGCTGATTTAAACAGTGCGTTGGAATGGTGTGAAAACGAATTCCTTTTTCAATATAAACAATTAAGAA
AAAAGGCGAAAGAAAGATTGGAAGAAGGAAAGCAAAATAATGTCGTATCCGCAGTAATTGCAGCCACTAA
AAACAAAAAAATTGATACAATAGGAAATGGTTTAAACAGGGGAAGCAATGGAGACACAGCGAGAAACTTA
ATGTCACTACCAACCAATACTCCTCGTAATTACCAAATACTTTCTGTAGCACAGAATGTATTTGTAAACG
ACGAACAAGCAGTGAAGAATTTCAAAAAGGAGTACAAAGATGATGAACCTGTCCTGCCTATATTGTTATT
TGCATTAAAGCAGTACCGACCCGATATAATATCTGAAGTTCAAAAAGTAAGAGAAAAGGAAATCAAGTTT
TGGGCACAACTCTGCCCCTACTTCACCAGGCGCAGATTAGCAAGTCAATCACATTTACTACATGCAGACA
ACATTTTTTTCCTTGTGGAAACAGGTATGTTGAAGGCAACATATGAACTACCACAAGGAACCTTGTACGA
GATTTTTTCAAATGGCACATGCTTCGGAAAAATCATTGCGCCAGGGAATGCTATGCCTAGAGAACAAAAG
CTCACCATCGAAACTGAAACTGATTCCGTATTATGGGTTATAGACTCTAGCTCGTTGAACAAATTGAAAG
AAGACAATCTAGCATTGTACGTGGAGGTTGCATTAATGGTCATGTGTATCAAGGACACCAGATTCAAAGA
ATTACTAGGTTACACACTTGTTAGCGCATGA

There is currently no text in this page. You can search for this page title in other pages, search the related logs, or edit this page.

Personal tools