Sequence:YBR220C

From Ytpdb

Jump to: navigation, search

YBR220C protein sequence

>YBR220C orf 560 aa
MEPKRKSGSLAKHDLPQFYLLIMLYLAQGIPVGLAFGTVPFLLKSLAKETSFTSLGIFSMATYPYSLKII
WSPIVDSLYNKRIGRRRSWIIPVQFVSGFVLWALGWCISQGIIFDGVDDAFHNRGNGTLHSVSIKNLTWW
FGLLVFLCATQDIAVDGWALTILSKESLSYASTAQTIGLNIGYFMSFTIFLSLNSSDFANKYFRNIPLDH
GFISLGGYMKFSGMLYIVITIYIIFCTKEKPYVEYLPKVEPINTSDGGSKPISIEYDDGDVVSTQNTSSI
KYIYRCFIKVLKLKSVRSLAFIHMISKFAFQCNEAATNLKLLEQGFKREDLAVTVLIDLPFEIIFGYYVV
KWSSDKDPMIRDNRRLRNSTGTNKVIKFLVGDAGVLTPWLWGFLGRLAAAVLGSYVVKQFPKDGEISTGY
FCLVIFQHLLGSFMNTVQFIGISAFHTRVADPVLGGTYMTLLNTLSNFGGTWPRLIIMSMINYFTVYQCT
IPGTNKVYVTHGGSMQACTELLNGTVTILRDGYYITNLICIVVGLFLYFGYLKRKILHLQSLPISSWRCT

YBR220C sequence

>YBR220C orf 1683 nt
ATGGAACCTAAGCGAAAGAGCGGGTCACTAGCCAAGCATGATTTGCCGCAATTTTATCTTTTAATTATGT
TATATTTGGCTCAAGGCATACCTGTAGGATTGGCCTTCGGTACCGTACCGTTTCTACTGAAATCTTTAGC
AAAGGAGACCTCGTTTACATCACTGGGAATTTTCTCTATGGCTACATATCCATATTCTTTAAAGATCATA
TGGTCACCAATAGTAGACTCACTGTACAACAAGCGCATCGGTAGAAGAAGATCATGGATCATTCCAGTAC
AATTTGTTAGTGGATTTGTGCTATGGGCATTAGGGTGGTGCATATCACAAGGCATAATCTTCGATGGTGT
CGACGATGCGTTCCATAATCGCGGTAATGGCACTTTACACAGTGTCAGTATAAAAAATTTGACGTGGTGG
TTTGGCCTGTTAGTTTTTCTGTGTGCCACTCAAGACATCGCAGTTGATGGTTGGGCGTTGACGATTTTGT
CCAAAGAATCCCTATCATATGCATCTACCGCGCAAACAATAGGTTTGAATATTGGTTATTTTATGTCATT
TACCATTTTCCTGTCGTTGAATTCCTCTGATTTCGCCAATAAGTATTTCAGAAACATCCCACTGGATCAC
GGGTTCATTAGTCTTGGTGGGTACATGAAATTCTCGGGCATGCTTTACATTGTAATAACCATATATATCA
TCTTTTGCACCAAGGAAAAACCCTACGTAGAGTATTTGCCCAAAGTGGAGCCCATAAATACAAGTGACGG
AGGGTCAAAGCCGATAAGTATTGAGTATGACGACGGTGATGTGGTGTCAACTCAGAATACAAGCAGTATA
AAGTACATTTACCGCTGCTTTATAAAAGTGTTGAAATTGAAGTCCGTAAGAAGCCTAGCCTTCATTCACA
TGATTTCGAAATTTGCCTTTCAATGCAACGAAGCCGCCACAAACCTGAAACTACTAGAGCAAGGCTTCAA
AAGAGAAGACTTGGCTGTGACAGTACTCATAGACCTGCCGTTCGAAATCATATTTGGGTACTATGTTGTT
AAATGGAGCTCCGACAAGGACCCCATGATTCGTGACAATAGAAGATTAAGAAACAGCACGGGCACCAACA
AGGTCATCAAGTTCTTAGTTGGGGATGCCGGCGTTTTAACACCATGGTTGTGGGGCTTTTTGGGCCGTCT
GGCAGCCGCGGTCTTGGGAAGTTACGTGGTGAAGCAATTCCCCAAGGATGGTGAAATATCCACGGGTTAT
TTTTGTCTCGTGATATTCCAGCACCTCTTAGGTTCCTTCATGAATACTGTCCAGTTCATTGGAATATCGG
CCTTCCATACAAGAGTTGCAGACCCCGTGCTGGGTGGCACATATATGACATTGTTAAATACCCTCAGCAA
CTTCGGTGGGACATGGCCGCGGTTAATCATTATGTCCATGATCAACTACTTCACCGTGTATCAGTGCACT
ATTCCTGGCACAAATAAAGTATACGTAACTCACGGCGGCAGCATGCAAGCGTGCACCGAGCTTTTGAATG
GCACCGTGACCATCCTGCGTGACGGCTATTACATCACCAATCTCATATGTATTGTAGTCGGACTTTTCCT
ATATTTTGGATATTTGAAAAGGAAAATCCTCCATTTACAAAGTCTGCCAATCAGTTCCTGGAGATGTACG
TAA

There is currently no text in this page. You can search for this page title in other pages, search the related logs, or edit this page.

Personal tools